Search results for " squat"

showing 8 items of 8 documents

Acute Effects of High-intensity Resistance Exercise on Cognitive Function

2021

The purpose of the present study was to examine the influence of an acute bout of high-intensity resistance exercise on measures of cognitive function. Ten men (Mean ± SD: age = 24.4 ± 3.2 yrs; body mass = 85.7 ± 11.8 kg; height = 1.78 ± 0.08 m; 1 repetition maximum (1RM) = 139.0 ± 24.1 kg) gave informed consent and performed a high-intensity 6 sets of 10 repetitions of barbell back squat exercise at 80% 1RM with 2 minutes rest between sets. The Automated Neuropsychological Assessment Metrics (ANAM) was completed to assess various cognitive domains during the familiarization period, immediately before, and immediately after the high-intensity resistance exercise bout. The repeated measures …

AdultMaleElementary cognitive taskmedicine.medical_specialtyfyysinen rasitusPhysical Therapy Sports Therapy and RehabilitationSquatAudiologyYoung Adult03 medical and health sciencesCognition0302 clinical medicineHeart RateMemoryexercise stressReaction TimemedicineHumansAttentionOrthopedics and Sports MedicineLactic AcidMuscle StrengthNeuropsychological assessmentback squatmedicine.diagnostic_testMuscle fatiguebusiness.industryResistance trainingRepeated measures designliikuntafysiologiaResistance TrainingCognition030229 sport scienceskognitiiviset prosessitreaktiotautomated neuropsychological assessment metricsMental RecallGV557-1198.995Sports medicinemuscle fatiguevoimaharjoitteluAnalysis of variancebusinessRC1200-1245030217 neurology & neurosurgeryResearch ArticleSportsJournal of Sports Science and Medicine
researchProduct

Teorie globali per azioni locali: i processi autonomi di riappropriazione dello spazio

2014

Le pratiche autonome di (ri)appropriazione e riconversione temporanea a fini “pubblici” di aree in disuso hanno fatto emergere nelle principali città europee (e non solo) e in maniera significativa in alcune tra le più importanti città italiane, esperienze di partecipazione interessanti dal punto di vista della sperimentazione di pratiche capaci di proporre politiche pubbliche dal basso e di costruire strategie alternative di “produzione dello spazio” (Lefebvre, 1991). Per poter costruire queste “utopie concrete” è come se i poveri, gli sfruttati, “coloro che non ci stanno”, ricorrendo a forme di disobbedienza radicale, definissero uno “stato d’eccezione proclamato dal basso” (Virno, 2012),…

Insurgent practices of reappropriation squatting participation neoliberal urban policies globalizationSettore ICAR/21 - Urbanistica
researchProduct

Tolerability and Muscle Activity of Core Muscle Exercises in Chronic Low-back Pain

2019

Most of the studies evaluating core muscle activity during exercises have been conducted with healthy participants. The objective of this study was to compare core muscle activity and tolerability of a variety of dynamic and isometric exercises in patients with non-specific low back pain (NSLBP). 13 outpatients (average age 52 years

MaleelectromyographyHealth Toxicology and MutagenesisbridgingRectus Abdominislcsh:MedicineIsometric exerciseElectromyographytrunkPlank0302 clinical medicinebridging electromyography plank squat trunkCore (anatomy)medicine.diagnostic_testBack MusclesMiddle AgedLow back painExercise TherapyplankTolerabilityFemaleChronic Painmedicine.symptomAdultmedicine.medical_specialtyPainSquatBridgingArticle03 medical and health sciencesLumbarsquatmedicineHumansLow back painPhysical therapy modalitiesbusiness.industryElectromyographylcsh:RPublic Health Environmental and Occupational HealthTrunk030229 sport sciencesTrunkCross-Sectional StudiesSpainSquatPhysical therapybusinessLow Back Pain030217 neurology & neurosurgery
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Formal property rights in the face of the substantial right to housing

2016

This paper explores the dichotomy between formal property rights and use value of rights in the field of the right to housing for homeless people, focusing on the entitlement of the squatting practices to claim the collective rights in the public domain. This collective claim can be considered an alternative to the ‘traditional’ conception of the public property as 'exclusive' domain of State. In the cities of Southern Europe, urban space has become an ‘object’ of contention by groups of inhabitants, who are organized at various levels, and an object of claiming – through illegal (although not illegitimate) forms of occupation of public or social private properties – the right to housing as…

capabilities approach right to housing squattingsquattingcapabilities approachright to housingSettore ICAR/21 - Urbanistica
researchProduct

Effects of internal kinetics and muscle activity during the wide and narrow barbell back squat

2017

Lahti, J. 2017. Effects of internal kinetics and muscle activity during the wide and narrow barbell back squat. Sports biology department, University of Jyväskylä. Master’s thesis. p. 102 (4 attachments). Introduction. The barbell back squat (BBS) is a commonly utilized strength exercise to support general preparedness for the demands in multiple sports. Recently, studies have shown various strength training exercises have the potential to recruit the regions of the hamstrings differently. Specifically, it is unknown if changing stance width under conditions where forward knee movement is restricted engages the hamstring regions differently and how this corresponds with measured 3-D net joi…

musculoskeletal diseasesback squatstance widthSports scienceliikuntatiedestrength trainingvoimaharjoittelumusculoskeletal systemhuman activities
researchProduct

CONFLICTING CITIZENSHIP AND (RE)ACTIVE ZONES IN THE URBAN AREAS: CONFRONTING THE CASE OF BERLIN AND ROME

In tempi di crisi, la voglia di immaginare un futuro migliore e diverso prende il sopravvento. A partire dagli sconvolgimenti politici e sociali del '68 passando attraverso le crisi sistemiche del 1970 e ad ogni crisi da allora, le città europee hanno assistito a fenomeni di "riappropriazione" di spazi fisici urbani che sono stati sperimentati da movimenti sociali e volontariamente appropriati poi come pratiche dal basso dagli abitanti delle citta` che hanno utilizzanto la "occupazione" come una tattica legittima di protesta. Le pratiche di riappropriazione, sono state inoltre messe in pratica dalla cittadinanza insorgente, negli ultimi decenni, per resistere alla crisi dello stato sociale …

squattingReclaiming spaces; squatting; insurgent citizenship; right to the cityinsurgent citizenshipright to the cityReclaiming space
researchProduct

Effects of 5-Week of FIFA 11+ Warm-Up Program on Explosive Strength, Speed, and Perception of Physical Exertion in Elite Female Futsal Athletes

2022

Futsal is a sport that originates from soccer and is increasingly practiced all over the world. Since training and warm-up protocols should be sport-specific in order to reduce injuries and maximize performance, this study aimed to evaluate the effects of 5 weeks of the FIFA 11+ warm-up program on explosive strength, speed, and perception of physical exertion in elite female futsal athletes. Twenty-nine elite female futsal athletes participating in the Italian national championships were divided into two groups: the experimental group (EG) underwent 5 weeks of the FIFA 11+ warm-up program, and the control group (CG) underwent 5 weeks of a dynamic warm-up. We evaluated any effect on explosiv…

vertical jump heightFIFA 11+Squat JumpAgility T-test FIFA 11+ jumping performance soccer sport performance Squat Jump vertical jump height warm-upsport performancePhysical Therapy Sports Therapy and RehabilitationOrthopedics and Sports Medicinesport performance; soccer; FIFA 11+; warm-up; Squat Jump; vertical jump height; jumping performance; Agility T-testwarm-upjumping performancesoccerAgility T-testSports
researchProduct